McDonnell Genome Institute

Washington University

CircRNA

chr3|52691541|52693329|+|GNL3|ENST00000394799.6

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9554

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

VESQMLK

Amino Acids from 5' Exons

VSQMWGKAALSIANKNRCVMLVYPWGLQ,FPKCGEKQHYQLKTRTDVCWCIHGAYK,FPNVGKSSIINSLKQEQMCNVGVSMGLT

Amino Acids from 3' Exons

VVLKYTVPGYRNSLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWT,YNILSQATGILWNFLLCLLREEVCTKKVESQMLKVLPNCCGLSGQ,STEIYCPRLQEFSGIFYCACSEKRYAPKRWNPKCRCCQTAVVVDR