McDonnell Genome Institute

Washington University

CircRNA

chr3|52561766|52589255|-|PBRM1|ENST00000296302.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9232

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

KAEYEEAEK

Amino Acids from 5' Exons

STPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYE,LPQSLPKAVQRRKAPNGKSTVATSCSAVRGLLRPNTQTTLSGSSAAWWGQNGEILRQPRKQNMK,YPKVCQRQCKEGRLQTENQHEWLHPVQQDEGCDGPTPRLLFRGAQPPGGDRMEKSDSQESRI

Amino Acids from 3' Exons

KLKRVKIPLVLQASQAYIAHTARTVALKTACTMLEITSMWNLQRPTYNHISSVLKDCGRIQL,SKERFLWCCRPLRLTSHIQPGLLKQHVPCWRLRLCGTCRGQPTTTYRLYKTVGGFS,AEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVYVEPAEANLQPHIVCIERLWEDSA