McDonnell Genome Institute

Washington University

CircRNA

chr3|52550420|52579199|-|PBRM1|ENST00000296302.11

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.947

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

SPTALASGIR

Amino Acids from 5' Exons

VGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLA,WEFWGLQGSRHHLHIPAHIQLDPLSYSSQQHPCLLPHQRPSGFFTQRPTNTLKDSVRSPTALASGIRHWQ,GSFGASRAAGTTSISRPTSSWTPCHTAANNTHVCSSPTKDPAASSLRGLPEIHRTQCGVQQHQVGSDTG

Amino Acids from 3' Exons

EKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVG,KKKMSLWKCPMVNQVATTLSSSITMTCGRLATVSSSSPMAWCVLVWA,KRRCPCGNVQWTRLPLLAAPLQHVAEGWRLCLHQVPWPGASSCGQ