McDonnell Genome Institute

Washington University

CircRNA

chr3|52246694|52249322|+|PPM1M|ENST00000323588.8

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

SEFNEDQAACGK

Amino Acids from 5' Exons

DYQCREIIQGSSRLWEAVHPEMVWGRRVADPVPRG,IINAEKSEFNEDQAACGKLCIRRCEFGAEEEWLTLCPEE,LSMQRNLNSMRIKPPVGSCASGDVSLGLKKSGPCAQR

Amino Acids from 3' Exons

VTVLDVDQLELQEDDVVVMATDGLWDVLSNEQVAWLVRSFLPGNQEDPH,LCWMWTSWSYRRMMWLSWQLMDSGMYCPTSRWHGWCGASSLGTKRTHT,DCAGCGPAGATGGCGCHGNWTLGCTVQRAGGMAGAELPPWEPRGPTQ