McDonnell Genome Institute

Washington University

CircRNA

chr3|52202506|52208247|+|ALAS1|ENST00000310271.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9029

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

23

Peptide

STQWGFMGLEAEGLGIGMESCQK

Amino Acids from 5' Exons

KTKLLRPRSNRLLMDPSRVQMAHSFRLDTPCLPQARALQANALSWQHRIREAAVSSAKPVLSFRRMCRKMPGK,RQNCGQGPTDSWIPAESRWHTASVWTPLACHKPGHCKQMPFPGSTDESERQQCLLQSQSASGGCAGNECREE,DKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGSSVFCKASLELQEDVQEMNAVRK

Amino Acids from 3' Exons

GRCAHWKSCVMWPMSLEQSPSWMRSTQWGFMGLEAEGLGIGMESCQKWTSFLEHL,GGVPTGRAVCGPVWSNHLRGGPRSGALWGSRRRDWGSGWSHAKNGHHFWNT,AVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTL