McDonnell Genome Institute

Washington University

CircRNA

chr3|51712472|51717817|+|GRM2|ENST00000296479.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9332

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

LAASLRPSCTSSSSSR

Amino Acids from 5' Exons

VANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEKVGRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAASQRLNASFTWVASDGWGALESVVAGSEGAAEGAITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHRALCPNTTRLCDAMRPVNGRRLYKDFVLNVKFD,WPTSGYFRSHRLATPLPVPSVTSPAMTTLPAQCLLTSSKPRPWLRFSASSTGPMCPLWRLRATMARQALRPLSRLVPATSVWPPRRKWAVPAARPLRVWCEPCCRSPVPAWLSCSPVLRMPGSCLLPASASMPASPGWPVMVGGPWRVWWQAVRGLLRVLSPSSWPPTPSVTLPPTSRAWTLGTTAGTPGSVNSGSRGSAAASGSETAQPTLSGLCPLSRSPRSCLWSMQCTPWPMRSTTCTVPSAPTPPGSVTRCGQLTGAASTRTLCSTSSLM,GQPLEAISDPTDLRLYQCQAEQVPLLLCPHSASLLPSQGHGDSPLLQLDLCVHCGVGRLWRDRHGLARGSCPQHLCGHLGESGPCHEPRGLGCGASPAAEAQCPRGCPVHPFGCPGAACCQPAPQCQLHLGGQWLGGPGECGGRQGGCGCYHHRAGLLPHQLCLLLPEPGPLEQQPEPLVPILGAEVPLQLPAARLRSPLSPGCALAGVQDHVCGQCSVRHGPCAPQHAPCPLPQHHPALRDAASRAPPLQGLCAQRQV

Amino Acids from 3' Exons

VQTTTMCVSVSLSGSVVLGCLFAPKLHIILFQPQKNVVSHRAPTSRFGSAAARASSSLGQ,YRPPPCACQSASAAPWCLAASLRPSCTSSSSSRRRTWLATGHPPAALAVLLPGPAPALAK,TDHHHVRVSQPQRLRGAWLPLCAQAAHHPLPAAEERGPPGTHQPLWQCCCQGQLQPWP