top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|51637160|51639999|+|RAD54L2|ENST00000409535.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9697

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

SLCLEFEK

Amino Acids from 5' Exons

SLRRLYAALALMSVMRDTASKTARPAPHRLRISALAAGWCLGTLCKTTSLSTGAWWTLCAQTSLAPGRSSATCLNALSMGNVLTAHLRTSASCGTGAMSCTVFWRALCR,VEGFMPPWPCSNLGTPHQKLPGQHLTGSEEYPLSPPGGADWVPSAKQPHVLVHGGLCAPRLPWHPAGVQQHVTPYPEWAMYQHTSGRPPHAVPEPCPAQSSGGLCAE,FEKALCRPGPDVVICDEGHRIKNCQASTSQALKNIRSRRRVVLTGYPLQNNLIEYWCMVDFVRPDFLGTRQEFSNMFERPILNGQCIDSTPQDVRLMRYRSHVLHSLLEGFVQ

Amino Acids from 3' Exons

AKDLLTNYQTGVLENSPKMVLLFHLIEESVKLGDKILVF,PRTFLITRLESKTLPRWYCFSTLRKVSLGTRSLCL,QGPSDLPDWSPRKLSQDGTAFPPDGKCEAWGQDPCV

bottom of page