McDonnell Genome Institute

Washington University

CircRNA

chr3|51629333|51630931|+|RAD54L2|ENST00000409535.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9614

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

AVKPHQK

Amino Acids from 5' Exons

KATPGGSIGACYQSSTARRVGKKEAPGAAEERLCSPYSYCSAGVPP,KLLREDQLEPVTKAAQQEELERRKRLEQQRKDYAAPIPTVPLEFLP,SYSGRINWSLLPKQHSKKSWKEGSAWSSRGKIMQPLFLLFRWSSSL

Amino Acids from 3' Exons

RLNALERRTLCTLWTAVNLSVKMMRKKRRVAPMSMMSTSVTPLGGSLSTTTLQRRKMSSLPHSWHGLNLI,GDTELWRGGHSAHCGQQICQRGRREGWHPCQCLKPARPWAGPCQPKPPSRGGKCLPCPTVGTGCETSS,VIELSSGEEDTLHIVDSSESVSEDDEEEEKGGTHVNDVLNQRDALGRVLVNLNHPPEEENVFLAPQLARAVKPHQ