McDonnell Genome Institute

Washington University

CircRNA

chr3|51386207|51387878|+|MANF|ENST00000446668.5

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9842

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

YVCISYLGR

Amino Acids from 5' Exons

FVFLIWEDFTRTSKTEMSHSHQPLLKTNLSSAGKQEAKRIG,LYFLSGKILPGPQRQRCHILTSHYKRTYKVLPGSKRQRESV,CISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRL

Amino Acids from 3' Exons

CYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKY,ATISGPQMMQPPKSSMRYQSLWPTTSLWRRSVRSLRRRTARYVSLSM,LLYRGHRCSHQNHQGIKASGPPHPCGEDLEAEEGQPDMAV