McDonnell Genome Institute

Washington University

CircRNA

chr3|49967469|49999513|+|RBM6|ENST00000266022.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9099

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

GVFTLGR

Amino Acids from 5' Exons

WEPRRKVCSRVEQGLSSSSPESCSRETLWQLSWQRFTSLFPGAFGASFCKCRGAFFQLWSRRTAWLSRRGGTWTFQGGRFFVFFPEQRFITVGLQGGHTFWGFSGRRTTYGLGWRWYFYGLRGGTSYELQRQGCSRCLQRGCSSILQGPGHLFRFRPGWIPCRFGKGFIRFGFGQRTVPFFERCIFGLRQRRNTSRLRPRFRYYSRLGQGYATFRFQRTPIDSGFGQRDGILYGIRGDAPCGSKYFGLHSALYTRRTFWYECEQERRIHTPYDRKACFWHSEGRIAFRNKRRRNTRCSLTVSSRLSEQPKSSSRPRVTAFWTRAEFRCWSVRRRRSGLSWAARHRLQKHGVPCGSAARKPDVWLWPEQVFSRGQNCPRCPTGPS,GSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGHSGPPFANVEEHSFSYGARDGPHGDYRGGEGPGHDFRGGDFSSSDFQSRDSSQLDFRGRDIHSGDFRDREGPPMDYRGGDGTSMDYRGREAPHMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQGVAFEHESPADFQNSQSPVQDQDKSQLSGREEQSSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFGYGQSKSFPEGKTARDAQRDLQ,GAKKKGLLPGGTGIILLLPLRVMLKRDTLATFLAEIHFPLISRGIRGLLLQMRSILSAMELETDRMVTIEEGRDLDMISGGEIFRLLISRAEIHHSWTSGVGTYILGIFGIEKDHLWTIGVEMVLLWIIEVGRHLITTETGMLTLLTSEVGMLLHLTSGAGALMIILEAGMDPMQILGEGIYQIWILGPENSPVLILGIEMYLIWTLETKTEHKTLEAEVQVLLITLGTGIRHIQISEVDTDLGLIRILGAERWDLVWNLKIGRCPLWIQIFWITFSPLHKIENILVMTGEKNPHMTIRKGLLLAFRRENLSIQKQEKEKHKVPLNMSLQQTFRTAKVQFKTKISHSFLDVKSRVQMLVCLKKKAVWTFLGGKTPITEAWSTVMWIIGCQEARCLAMARASLFQRAKLPEMPNGTF

Amino Acids from 3' Exons

VTTMAMSAWSFHSWKMPSDAWRPT,LRLWLCLRGVFTLGRCHRMHGGQP,YDYGYVCVEFSLLEDAIGCMEANQ