McDonnell Genome Institute

Washington University

CircRNA

chr3|49302383|49305888|-|USP4|ENST00000265560.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9455

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

14

Peptide

DANGRPDACLSNTAPLTDYFLK

Amino Acids from 5' Exons

TQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDA,LKDVLLLNFLATSNKILRSCWPFFMDCMKITGRKSPTWSRMPMGGQM,SSRTFCSSIFWLPATRFSGAAGLSSRWIARSEPGKEKALLGAEGCQWAARC

Amino Acids from 3' Exons

CLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFK,VATLHHLTTFSKMSMKPKSTETTLWGKGKLQKPMLNSLSRCGLEGTPMWHLACS,FEQHCTTDLLSQRVSRNQQRQPSGDERGNCRSLCTHADVVWKGRPCGTSHVQ