McDonnell Genome Institute

Washington University

CircRNA

chr3|49286097|49302542|-|USP4|ENST00000265560.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9239

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

FSGAAGLSSR

Amino Acids from 5' Exons

EKMRKKWSIRKKAKSSFQKQKAVGKMSQEMTPVRPPKRRSKASPAQKGFLPSVLTPMEQLTIHLQLMENYLNST,RRGRNGASGRRQRAAFRNRRQWGRARKPQDHPKEDQRPALPKKAFYLQSCELLWNSHKFTCSWKTTTQ,EDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLN

Amino Acids from 3' Exons

TQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDA,LKDVLLLNFLATSNKILRSCWPFFMDCMKITGRKSPTWSRMPMGGQM,SSRTFCSSIFWLPATRFSGAAGLSSRWIARSEPGKEKALLGAEGCQWAARC