McDonnell Genome Institute

Washington University

CircRNA

chr3|47915950|47917174|-|MAP4|ENST00000360240.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

26

Peptide

GISEDSHLESLQDVGQSAAPTFMISPVPLELAK

Amino Acids from 5' Exons

FPSPRRKWHQKRGHQHKHWKWDRLLTWHHLKKQRWPSPRTWHLQKPRWHWLKIWNHPPNMHWPRTCSHPWNQIWPSRTWNYPQKKKWPWLRMSDGPQKQMYLQPRMWYCPQKQRPQPRMHCKKQRGHLLKWTPLPRTWDHPKKTRKKQRGHLLKWTWLLPRTWDHPKKTRSQPRIWYYSQKRWHRLMTLYHPQKYPLLRRWLCPQKQRPWPGTHCPRKPTSPRIKHYLKQRWPQSRTWLNSQKQKPRPRMWLRPQKKWACRTCLHYQKQKWLWARMLHLQKQKFSSRTYVCLQKWRWPLRIRSQPSKQKHPWLRMGFPWPTMLQPKMFHHSQKQRQHQFQLKTWKLHKHKKEVRIPINLCRMWGSQLHLLSFHQ,SLRASQGDRNGIRREATSTSIGNNDGTEDYHGTIRNRDGPRQGHGTSYKNRGGIGRYGITHQIRCDTGQGHAAIHGIRYGPSQGHGTTHRKRSGPGGCQMAHRNRCIFSQECGTAHRNRGSPSQGCDTVERNREGISYKNGLSPFQGHGTTQRKQERNREGISYKNGLGSFQGHGTTQRKQDSPSQGFGITLRNRGGTGHYIIHRNILCEGGFVLRNRGSPGQGHDTAPGNQRDLDQGSTTFRSRGGPSQGHGSTPRNRNSPGQGCGSVHSKRSGLVEGHVSTIRNRNGSGQGCDSTSRNRSSSHQERMSASRNGGGPDGSGPSPQNRSTPGGWGSDPGQQCDSSQRCSTTLRNRGNTSSNRHGNCTNTKRNKGFPFRISAGCGAVSCTYFHDFT,PLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTLLKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAKDVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISP

Amino Acids from 3' Exons

FPSPRRKWHQKRGHQHKHWKWDRLLTWHHLKKQRWPSPRTWHLQKPRWHWLKIWNHPPNMHWPRTCSHPWNQIWPSRTWNYPQKKKWPWLRMSDGPQKQMYLQPRMWYCPQKQRPQPRMHCKKQRGHLLKWTPLPRTWDHPKKTRKKQRGHLLKWTWLLPRTWDHPKKTRSQPRIWYYSQKRWHRLMTLYHPQKYPLLRRWLCPQKQRPWPGTHCPRKPTSPRIKHYLKQRWPQSRTWLNSQKQKPRPRMWLRPQKKWACRTCLHYQKQKWLWARMLHLQKQKFSSRTYVCLQKWRWPLRIRSQPSKQKHPWLRMGFPWPTMLQPKMFHHSQKQRQHQFQLKTWKLHKHKKEVRIPINLCRMWGSQLHLLSFHQ,SLRASQGDRNGIRREATSTSIGNNDGTEDYHGTIRNRDGPRQGHGTSYKNRGGIGRYGITHQIRCDTGQGHAAIHGIRYGPSQGHGTTHRKRSGPGGCQMAHRNRCIFSQECGTAHRNRGSPSQGCDTVERNREGISYKNGLSPFQGHGTTQRKQERNREGISYKNGLGSFQGHGTTQRKQDSPSQGFGITLRNRGGTGHYIIHRNILCEGGFVLRNRGSPGQGHDTAPGNQRDLDQGSTTFRSRGGPSQGHGSTPRNRNSPGQGCGSVHSKRSGLVEGHVSTIRNRNGSGQGCDSTSRNRSSSHQERMSASRNGGGPDGSGPSPQNRSTPGGWGSDPGQQCDSSQRCSTTLRNRGNTSSNRHGNCTNTKRNKGFPFRISAGCGAVSCTYFHDFT,PLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTLLKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAKDVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISP