McDonnell Genome Institute

Washington University

CircRNA

chr3|47909037|47914939|-|MAP4|ENST00000426837.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9955

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

LSFCEDQNAQDR

Amino Acids from 5' Exons

PTSCIAVPLPHKPNKFADPVTAGQPGPSLPGSLLSCWEALLHGRLLITGWATALCLSQVGSLVHPPVVGLGTKEKVFMLTHLNPRGILAGRPGIKAHQRKRRRNQSKRDILNHGLEDLRMMTMQISLKVIHLQLTHKNQVFSPASLPLWVQNMDLYLEKTKGNVLTPVQPDWLRTLSQRVSEFLYILLKKPPKLQVLSLSERKRAKVTSQYYKTKTRNCSNMNTNHSLHPTRLLIKASQALSIKDPQKFLHTMKPLWISDLKRVALLSWTKRLWVFQNPQQQKKYQIWYPLQVIHNVIKKGIMKVKLNCRMSNRSFLKELKRIKNKRKLFPTKDKRSASLLLSSCRAKCWYRSLGRMNHLREWQVMAKAGREGEVLGKEQILGRKQNLSCHFFWTARRTEGLFSYRVSQSLKLKELLRIRVRSWGILQSNQALRLISRRQWWGSLKRLSLRWQAPCRHFLWKVDQALRLLVLAQKQEMSKIWVSITRARKEGVHGRIMRQLPGFLKSLKREAMKAKAKSLKIIIPHSLLEWRGRKKSLTHLLKGRMEILVVFPIKARKDLLSPKCMILRSHIHQIHPQWKQLTGRVEIFRLILLSLGLLGKTRAQSRLLLLLNHLPRQMAAKSKSRGQDLFLQYLRRIRQMQPIDTLQWLTNQVKGVMMEKVKRLKIVLLRSTFWRIRMQQKYMFPWKPQGTRELKEWPIWTKIEILHLPVPEHHQSINHLLRFWNQQPVKNCPLLLLKRKVIPFQIPWQKMGKRPQPRFPNHWITTPKMESQVKKDPRVPLLLCPLQAQEELLYLLQQPKQLTFMEITLLRIKLSLLIPKMKQGSMKGMENLSQCTVVRLSIQRKSQSQKVTSFLECQKTRAYQERPEPKDMQIEVISQHIQMKRKRLKKGLLQFRFLTYWKTKHKSSVFVRTKMLKIEIPKVQIVIRRILFCLQKVKMINKKLVWLVKSRNWKAFPCQHQKSSQISYIAKSKLLLQRWRIRLLPRVFDSQNPKIRFWRHLRKQKNLNQRHQEKGKRKIKAEWQNQKATDPPSPEDLLHFCQSLQSRNKRDISNSPL,QLHVLRYPSHTSQTSLQTQPQVNPAQACQGPSAAGRLSSMEDSSQAGPLLFVVRLGLWFILLWWAWEPKKKYSCLTTPEGSWQGGLGYRKHTNNDEEKEEETKAKEIFSTTGWRTFGQCRARSSICSHTKIRCSPQPAYHYGYRIWTCIWRKLEKGMFSLQCSQTGSELCLRESQNSFISFRSPQNCNKFSVAESRGREQKQVSTTKPRQEIAEATIQTTACTPPEDSCRKPVSRPSQSERTPSRSFCIQCRNPFGYQTRGLLSFLGPRGYGCSFKTHSSKRNTKFGTHFDSKSIRMSKRREKNDTAECQTEGVSRSRGRTKKGSFSQRKTRDQHLYFAAAGPSVGTGPWGRETIENGRWQKQEGKGKFWENENRFWEGKSKIAAISSGQPEGRKGCSHTEASLNRNDYSGEGAGAEFFKATRHGSHGGSGDGGARDDSAGGRHHAGIDSFGKWIRHDSDFWCHRNRRCSQRYGCQPEQGRKVSMEGSGSSLDFKAKERQRQKQKVKLFHTACNGEEGRNPPTFREGWRYWYSPKQGNRIYFPQNAFFVLTYTRYTHSGSSQEGWKFSGFCAWDSWGKQDKHSQGFYCYTTCQGDRCELPRANPGGRICSFSSIGEDRCSQIHCSGQTKKEWKKKGKFSEAHSGEDRCNKNTCSHGNHRGPGNRNGLYGRKKYYIYLSQNTIRADKIISSRGSGISSLKTAHSYSSSSKGRFLSRYLGKKWARDSPSPDFQIINGRLHQRWSPRSRKTQGSLCCCALYKHRRSCSTYYNSHRNSHSWRSLSESACFHEKSRDRRACDRRIVSAQWCVAFSRESHRASKRSPPSWSASRRPEPTRRGQSPRRICRRFPSTSSERERDRRVCCSSDSLTGRQSTKAQFLGPKCSRKFQRFRFEEGRSDSFVSKKKIERNSGLNHGIGKRFLANTRNPVRFLTQSRSSSFRGGGYVSNNDCFQGCSTPRTQRDFGDTSENDRKIIKDTRRREKGRKQNGRTNERLHETHQVPRTYSTFAKVYNPGTRETATEVR,NFMYCGTPPTQAKQVCRPSDRRSTRPKPARVPPELLGGSPPWKTLDHRLGHCSLSESGWVSGSSSCGGPGNQRKSIHVDSLEPQRDLGREAWDIESTPIMMKKKKKKPKQKRYSQPRAGGPSDDDNADKPKGHPFAADTQKSGVLPSQPTTMGTEYGLVSGENLKRECLVNSSAARLVAENFVSESLRIPLYPSEEAPKTAISSQSKLRVEEESKSNKSVLQNQDKKLLKQHEYKPQPAPHLKTPVDKSQSVGPLNLKGPLAEVSAYNVETPLDIRLKEGCSPFLDQEVMGVVSKPTAAKEIPNLVPTLIASNPLECNLKEGNNESKMTKLQNVKLKEFPEGAEEDKELKKEAFPNERQEISIFTSEQLQGQVLVQVPGVENEPFKRMAGDGKSRKGRGSSGKMRTDSGKVKAKSELPFLLDSQKDGRAVLIPSEPVSKTEGMTTQDKSEELGLNSSKQPGTKADLTEAVVMGEPKEMTQPKVAGTMQALIPLESGSGMTQTSGVSTETGDVVKDMGVNNQSKEGRCPWKDHEAAPWISEKPKKRGNEGKSKKFKNNYSTQPARMERKEEILNPPFEGKDGDTGSIPHKSKEIGFTFPKMHDSSFSHTPDTPTVEAVDRKGGNFQVNFVELGTLGENKISTVKASTVTEPPAKVTDVSCQEQIQGAGFVPSVVSEENKTDAANRYTAVADKPSKRSNDGKSKKVKNSSPEKHILENKIDATKIHVPMETTGDQGIEGMAYMDENRNITFTCPRTPSELINKSSPLEVLESAACEKLPTPTPQVVKEGDSFPDTLAKNGQEIAPAQISKSLMVDNYTKDGVPGQERPKGPSAVVPSTSTGGVALPITTAIETVNIHGDHSLKNKAELADSMKNEAGIDEGHVIGESESVHSGASKHSVEKVTELAKGHLLPGVPVEDQSLPGEARALEGYADRGNFPAHPVNEEKETKEGSVAVQIPDLLEDKAQKLSFCEDQNAQDRNSKGSDSLNKKVDLTLLSPKSENDKLKEISLACKITELESVSLPTPEIQSDFLHSKVEAPPSEVADTLVIMTASKGVRLPEPKDKILETPQKMTEKSESKTPGEGKKEDKSRMAEPMKGYMRPTKSRGLTPLLPKSTIQEQERHKQLKSA

Amino Acids from 3' Exons

KPSQERGKSAACRPRRILCKNGKGNHATVNLLSFLQRPQ,NRHRNGEKVQLAGRGGFCVRKTRGKETMQQSTFAFFRDL,TVTGTGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETS