McDonnell Genome Institute

Washington University

CircRNA

chr3|47855247|47872100|-|MAP4|ENST00000335271.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

6

Peptide

VGSLDNVGHLPAGGAVKPIADAK

Amino Acids from 5' Exons

VEEMSRLKVRSTSRRRPRPRWDPSIMWATYLQEVL,WRRCQDKSEVELQGEGPGQGGIPRCGPPTCRRCCE,GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVK

Amino Acids from 3' Exons

PIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPT,PLQMQRLLRSGPHHPSQLLPQPPDLGPRALRLLQKPQQLLLLPQLAQAVGAPPRSCPRSPL,HCRCKGSEAGLTIQASFCPSLQIWVQEHSDCCKNHNSCCCCLNWPKQEPLHAPAQEAH