McDonnell Genome Institute

Washington University

CircRNA

chr3|47848919|47849349|+|DHX30|ENST00000348968.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.982

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

GVLMAGLYPNLIQVK

Amino Acids from 5' Exons

VKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRSSRENYLEENLLYAPSLRFIH,KHCAMTAAVTTWPLCGLSPAGRRCCVGRTAAPGRITWRKTCCTHPACASST,ESTVEPQRQPPGLCAGCRRLGGGAALAGPQLPGELPGGKPAVRTQPALHP

Amino Acids from 3' Exons

DSSSSSQRTFMRPSWWGSPRTAPWPPPSATSTVRRRSWRACWPASTPTSS,THQAVLREHLGLPGGEALGLHPGLRPVQRVQGGGAGEGRADGRPLPQPHP,LIKQFSENIYEAFLVGKPSDCTLASAQCNEYSEEEELVKGVLMAGLYPNLIQ