McDonnell Genome Institute

Washington University

CircRNA

chr3|47638724|47662592|-|SMARCC1|ENST00000254480.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

11

Peptide

MEADPDGQQPEKALEMYKDDWNK

Amino Acids from 5' Exons

KELKRKKWKPTLMVSSLK,RSRGKNGSRPWSAAK,GAEEEKMEADPDGQQPEK

Amino Acids from 3' Exons

ALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAAL,PWRCTRMIGTKCRNMLEVVLRMNASSTFDFPLRTHTLRIQMLPLGLWPTSLSPSVSQEIQLVLLLFWHLWWTLAWHLLQQKRLW,PGDVQGLEQSVGTCWKSYSGMHPPLFETSHGPIPEFRCFPWAFGLPACPLQSVRKSSYEYCCFFGICGGPSRGICCSKSGF