McDonnell Genome Institute

Washington University

CircRNA

chr3|4706166|4735354|+|ITPR1|ENST00000302640.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9211

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

STTSFSSPTALCR

Amino Acids from 5' Exons

PRAGPLPFPWTWTAKSTTSFSSPTALCRKQPTGGSQPAMPHAGTLFWQLPETTGISLRDC,QEPGHCHSRGPGQPSQQPLSQVPQHCAENSHELAALSPQCRTQGLCSGSFQRLPEYHEIA,KSRAIAIPVDLDSQVNNLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQ

Amino Acids from 3' Exons

GEVPDPALAGVRVWPRFSVTLTRRGLPILSTSSTHPVTECSMKAFSWPLPFWKEATPPS,GRFRIQLYEQGDESGRGSVSPQGGGFQSSYRPHHERIQPSVPKHSPGHCPSGRRQHHHP,GGSGSSSMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQ