McDonnell Genome Institute

Washington University

CircRNA

chr3|4675067|4768764|+|ITPR1|ENST00000357086.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9661

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

DLQVVNLAR

Amino Acids from 5' Exons

VVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEENK,LILGISYTLVSTTSLTFYDLRSFWPYWTVYMQQSSPLARWRKEKRIK,CKFSESHILWFLQLLPSTINDPSGHIGLCTCDNNLPHQDGERRRE

Amino Acids from 3' Exons

LKSPQHRQKRSGISSWRPPLPPGKPSPLSGGRLIPTTTTSLERAPRPLPTRPRTTWRARSSPSCSPSSASFSSCVKTTTETC,RAHNTDNRRGPGSAPGGLRCHQESLHHFQEGGSRRPLPAWRGHPGHCRQGQGRPGDERGHHHHAAHPPLPSAPVKPQPRPA,KEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQ