McDonnell Genome Institute

Washington University

CircRNA

chr3|4658123|4662242|+|ITPR1|ENST00000302640.12

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9807

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

RWYTPWSLCLK

Amino Acids from 5' Exons

VDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVP,WTLIRTPLEVGCGMPKKRWYTPWSLCLKAMTSPPFSSIPPLCVEVTALSQ,GPSGRLSKVAECPRKDGILPGLCARQHLLHFRARSHHSAWRQPCPK

Amino Acids from 3' Exons

IGTSPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNER,LAPLLRRIRKHLPFRFLLLKFGTWTLPMMPARCWAPLLGSRRAPSPRMKG,WHLSCEGGGSICHSSGFSCSSGPGLCQCQQGAGLHCWEAREGHHHPEKE