McDonnell Genome Institute

Washington University

CircRNA

chr3|4652122|4688620|+|ITPR1|ENST00000302640.12

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9239

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

9

Peptide

HINLFLNPGVVQHDPCR

Amino Acids from 5' Exons

VVQHDPCRGGAGYWNSLFRFKHLATGHYLAAE,WSSMTHVGAEQGIGTAFSVSSIWPRGITWQQ,GPAPMSGRSRVLEQPFPFQASGHGALLGSR

Amino Acids from 3' Exons

AEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPG,PKIPRCKRGWLMNFCRISAQATSRIKLCYINTTCFSTQ,RRYQDARDNEVGSIFAEFLRRQPAESSFATTHKPVSQPR