McDonnell Genome Institute

Washington University

CircRNA

chr3|46441415|46450673|-|LTF|ENST00000231751.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9839

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

20

Peptide

DVTVLQNTDEDLSDEAERDEYELLCPDNTR

Amino Acids from 5' Exons

VPGECWRRCICERCHCLAEH,CLAENAGDVAFVKDVTVLQNTD,AWLRMLETLHLKMSLSCRTLM

Amino Acids from 3' Exons

RTCQTRLKGTSMSYSAQTTLGSQWTSSKTAIWPGSLLMPLWHEVMARRMPSGIFSARH,GPVRRGKGRVVTLPRQHSEASGQVQRLPSGPGPFSCRCGTKCEWQGGCHLESSPPGT,DLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQ