McDonnell Genome Institute

Washington University

CircRNA

chr3|44812181|44831018|+|KIF15|ENST00000326047.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9727

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

ILSEDIEEQMSALQAK

Amino Acids from 5' Exons

EQMSALQAKLDEEEHKNLKLQQHVDKLEHHSTQMQE,NKVLFKPNWMKKSIKTSFSSMLTNWNIILPKCR,TNECSSSQTGRRAKPKASAACQTGTSFYPNAG

Amino Acids from 3' Exons

CKYNSALVDREESRVLIKKQEVDILDLKETLRLRILSEDIE,ANTTLLWLTEKRAECSRSRKWIFWIKKPLGEYFLRT,QIQLCFGQRREQSVDQEAGSGYSGSERNPAENTFGHR