McDonnell Genome Institute

Washington University

CircRNA

chr3|44775253|44775437|+|KIF15|ENST00000326047.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.905

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

10

Peptide

LIMLQMWIPLSNEGDAIK

Amino Acids from 5' Exons

RCHQSFCANSSSCRKIWVSWRAELMLICAVLHESPAALQPAQDLHVSCCRCGYHS,NEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLRLHSNPEPKTFTFDHVADVDTTQ,MKVMPSKFLCEFVLLQKDLGQLMESRTYAYLCCPPRVSGCTPTLSPRPSRLIMLQMWIPL

Amino Acids from 3' Exons

RCHQSFCANSSSCRKIWVSWRAELMLICAVLHESPAALQPAQDLHVSCCRCGYHS,NEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLRLHSNPEPKTFTFDHVADVDTTQ,MKVMPSKFLCEFVLLQKDLGQLMESRTYAYLCCPPRVSGCTPTLSPRPSRLIMLQMWIPL