McDonnell Genome Institute

Washington University

CircRNA

chr3|38125564|38126700|-|ACAA1|ENST00000411549.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

27

Peptide

MPSYPNSLPLGNSSQVSDGAAAILLAR

Amino Acids from 5' Exons

AAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGK,LPTVWRSYDSPLRRTPWGVQWPGTHWAALGHDRSSRCSMSSAVGR,CLLCGEATTPPEGEPPGGCSGLRAPTGLHWGTTGHHAAQAEAPWEE

Amino Acids from 3' Exons

GSKSPEQGLFPSDCACDHHGPQGHQEEHHCDPGGYPPQHHHGGPGQTEACLQERWFYHSWDWSGVGVESRPWPCWVLYSGNLETRPLCKVEVGGLGSPHPHPDAFLPQQFAPRKLPGEWGSCHPAGPEVQGRRVGPSHPWGPEVLCSGWGPTHHGHWTCLCHPSSFAKS,AARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGETGPGGYEKAGHGHAGCCTLGTWNRPGPSAKKWEGWDLLIPTPMPSYPNSLPLGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKA,QQEPRARAVSKLRLCLPPRSMMTRAPRGASLPRMRVSAPAPPWRAWPNSLPSRKMVLPQLVRLVRGRGMRKQAMAMLGAVLWEPGIDQAPLQSRSGRAGISSSPPRCLLTPTVCPETLARVMGQLPSCWPGGPRQKSWAFPSLGSGLMQWLGSHLTSWALDLPMPSQLCKKQ