McDonnell Genome Institute

Washington University

CircRNA

chr3|37542424|37629336|+|ITGA9|ENST00000264741.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

ESGLNYVLMADVAK

Amino Acids from 5' Exons

AIMFWLTWPKRRRARCPGSTLCCWERPWVRSQRSCSLTWRRRVVTMWPM,PELCSDGRGQKGEGPDAQGLLCAAGRDHGSGHREAAADLHGGDVSSLCGPCE,LNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVK

Amino Acids from 3' Exons

RRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ,GGCRTSSARSCLKQPTASVSMLERRRGNCRLHQFSAGKRDKRLPKRI,EGAGRHQPDRVSSLQPQACDWRGGEGTAASDTSSPLEKGTKDCPKES