McDonnell Genome Institute

Washington University

CircRNA

chr3|36996623|37026007|+|MLH1|ENST00000455445.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9389

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

CQRREDLLPATPDAK

Amino Acids from 5' Exons

MQNPQVFKLLKREASFRSKTMAPGS,CKIHKYSSDCRGRPEVDSDPRQWHRDQ,AKSTSIQVIVKEGGLKLIQIQDNGTGIR

Amino Acids from 3' Exons

TLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNP,LCYQDLLAPLGRWLNPQQVPRLLLLEVVIRSMPTRWFVQIPGNRSLMHFCSLANPCPVSPRPLSQRIRQIFLVAGLGSKMRRCLNSQPLLKWLPKIRAWRGIQQRGLQKCQRREDLLPATP,FATRTCWPLWGDGIHNKSDLVFYFWKGLCPPDGSYRFPGTEACISAASEQTPVQSAPGHCHRGDRYFWQGAARGDATPSPCSGCQKSELGGGYNKGDFRNVREERTYFQQPQ