McDonnell Genome Institute

Washington University

CircRNA

chr3|33411580|33439925|-|UBP1|ENST00000283628.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9628

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

TSAFIQDAPAELR

Amino Acids from 5' Exons

IFQCLWELTQGRIQASMRLNFCGTQQNAPLLSF,YSNVCGNNHKDESKPVKCGISVGPSKTHLCFHS,IPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQ

Amino Acids from 3' Exons

DAPAELRLLRPGRGGRGVRGDGEAGRWPGCSRWTRSSPGWCTTSTPASRASGRNWAPALTA,TRQRSSGSFALDAEAAVCGATARPEDGLGAQDGRGDRVRAGARLRRQPLGHRAGTGRRRLQHE,RASGAPAPSPWTRRPRCAGRRRGRKMAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSM