McDonnell Genome Institute

Washington University

CircRNA

chr3|33120343|33130067|+|CRTAP|ENST00000320954.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9113

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

16

Peptide

NLWLPCIITCSLPIISANNLPK

Amino Acids from 5' Exons

ANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYE,QIISPKPSPLLTPFYSILMTKRGTWHIIRACLVPRTTLKTWKPSHM,KSPQSHRRCSHLSTEASRNDEEEHGILEPAWCRGLHRPGNQVI

Amino Acids from 3' Exons

IIMKFWNAKYSVKRTSPQLEAIRLRNLWLPCIITCSLPIIS,SLCRSSGMQNTVREPHPSYRRLSGEICGYHVSLLAVCLL,HYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYK