McDonnell Genome Institute

Washington University

CircRNA

chr3|33014055|33072713|-|GLB1|ENST00000307363.9

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.997

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LTIAGTPSSR

Amino Acids from 5' Exons

GLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTK,VWFLTLSVPISSRTGRSFHWTLRMQCAATWGAGDTVTVATMMKPGPTTHPTTRSRPFIWGTSPFPVGSQTCPRTPLSSFLDGP,FGFPDSQFQYPHGLDDLSTGHGCSVQPPGGLGTPQWPPSLGPQLIQLHAPGLLYGELLHSQWDPRLAPGHLYPVSWMDQ

Amino Acids from 3' Exons

NATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQ,MPPRGCLKLTIAGTPSSRMASHFATSQEAFTTPVCPASTGRTGCRRWLGTPSR,CHPEDVNLPGLLPQGWPAISLHLRKHSLLPCAPLLLEGPAAEDEDGWAERHPD