McDonnell Genome Institute

Washington University

CircRNA

chr3|33014055|33058269|-|GLB1|ENST00000307363.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9611

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

21

Peptide

SAFATIWGMMWFCLPLMEHIK

Amino Acids from 5' Exons

GLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTK,VWFLTLSVPISSRTGRSFHWTLRMQCAATWGAGDTVTVATMMKPGPTTHPTTRSRPFIWGTSPFPVGSQTCPRTPLSSFLDGP,FGFPDSQFQYPHGLDDLSTGHGCSVQPPGGLGTPQWPPSLGPQLIQLHAPGLLYGELLHSQWDPRLAPGHLYPVSWMDQ

Amino Acids from 3' Exons

VENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGT,LKMNMAATLPVILTTCASCRSAFATIWGMMWFCLPLMEHIKHSNVGPCRASTPRWTLEQ,KIWQLLCLFLPALPAEALSPPSGGCGSVYHWSTNIPEMWGPAGPLHHGGLWN