McDonnell Genome Institute

Washington University

CircRNA

chr3|31623673|31629411|+|STT3B|ENST00000295770.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9758

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

FGEMQAGK

Amino Acids from 5' Exons

AGKVRKHATEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHD,QVKGNMQLNRKKLKRDALIKALSPCCCYCLLSTVPGSQAMPTLVQVSWPHTIMM,RSEETCNTGKNRGIRPYKKHCHHVDADAIDDVCCPLYLGHKQCLLSKCSPGLIQSW

Amino Acids from 3' Exons

ESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQ,KVTILPHRENSVTKQDPLLCIALCIKCHTTDLEKC,KLFYPTGRIPCRQSRIPYFVELPYVNVILQIWRNA