McDonnell Genome Institute

Washington University

CircRNA

chr3|27379248|27398353|-|SLC4A7|ENST00000419036.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

ALSMNTENAK

Amino Acids from 5' Exons

CSLNCHIRNGQNCTVEGTFHEYECQSNQIHE,VDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNM,LIPQLLTYQMKWPKLHSGRHFPILRMPKPDLT

Amino Acids from 3' Exons

ECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSSFLKQFKTKRYFPTK,NVKNFVVYSWGQLVVIMDLIFQMCSFGVSSCFSQHFFCLHSSSNLRPSVTFLP,MKTSWCILGVSLWSSWTLYSRCALLVCHLVFHNIFSVFIPQAIDQALLSYQ