McDonnell Genome Institute

Washington University

CircRNA

chr3|25737333|25778688|-|NGLY1|ENST00000280699.13

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9668

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

5

Peptide

AVGFEARYVWDYTETLMMK

Amino Acids from 5' Exons

IPETFGNKMWTVWRVGQLFYTVLPSCRVSSLCLGLH,YNNPEKLLETRCGRCGEWANCFTLCCRAVGFEARYVWDYT,IITLRNFWKQDVDGVASGPIVLHCAAELGLKLAMFGITQ

Amino Acids from 3' Exons

KPKIIHPDWKHSLFYTLACQRSCMFINGLR,NPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEE,TLMMKNIDPSGLETQPFLLDSCLSEELLNVYLKWALK