McDonnell Genome Institute

Washington University

CircRNA

chr3|25729132|25736149|-|NGLY1|ENST00000280699.13

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9308

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

SILLLSSGGCTVMHVK

Amino Acids from 5' Exons

RKETLFIPCENEKISKQLHLCYNIVKDRYVRVSNNNQTISGWENGVWKMESIFRKVETDWHM,EKKPCLFPVKMRRFLNSSTFVTILKIVMFEFQITIKPFLDGRMACGKWNLYSEKLKQTGT,KRNLVYSLKEDFTAPPLLQYCERSLCSSFKQSNHFWMGEWRVENGIYIQKSNRLAH

Amino Acids from 3' Exons

TMSGQKSILLLSSGGCTVMHVKMSVTSHSFMKDGARSFPMSHFQKM,PCLDRSLFSFSAAVAALCMRCLQATPLNRMGQEAFLCHSIFKR,HVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYVIAFSKDE