McDonnell Genome Institute

Washington University

CircRNA

chr3|25635935|25645470|-|TOP2B|ENST00000264331.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9797

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

LPTLFDQNNAAK

Amino Acids from 5' Exons

TWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLP,HGIIRLLKPKLNILMVKITHAHSNQICPNLRWKNLTRILWPSLEGHMIWLVRVEGSRSCLMERNC,MDEYDEDFSQNTFWRLHMHNIPTRSVQIDGKTQGYCGPHDKGIFGWFVRGQGHVWKEIA

Amino Acids from 3' Exons

TLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDTYIGSVEPLTQ,LFLIRTMLQKKKSQKLPTKMILQRSCLLRECIRRRHNLNTFFFVLIHILGQWSHR,SFSEQCCKKRRVRNCQQKFFKEVVCESVSEEDTTTHSSSSYIYWVSGAIDA