McDonnell Genome Institute

Washington University

CircRNA

chr3|25635935|25645455|-|TOP2B|ENST00000424225.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9818

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

KLPNNAAK

Amino Acids from 5' Exons

TWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLP,HGIIRLLKPKLNILMVKITHAHSNQICPNLRWKNLTRILWPSLEGHMIWLVRVEGSRSCLMERNC,MDEYDEDFSQNTFWRLHMHNIPTRSVQIDGKTQGYCGPHDKGIFGWFVRGQGHVWKEIA

Amino Acids from 3' Exons

NNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDTYIGSVEPLTQ,TMLQKKKSQKLPTKMILQRSCLLRECIRRRHNLNTFFFVLIHILGQWSHR,QCCKKRRVRNCQQKFFKEVVCESVSEEDTTTHSSSSYIYWVSGAIDA