McDonnell Genome Institute

Washington University

CircRNA

chr3|25633840|25636148|-|TOP2B|ENST00000264331.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9973

73

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

13

Peptide

GFQQISFVNSIATTKTWMNNMMKTSEAK

Amino Acids from 5' Exons

VNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTK,MDFAVMIFMKTNWMKLGWPKLFMSLQMKDGMFVSHVKKDSSKSALIVLQLQ,KWISQLCRSLCERQIGNWGGPESYSACKKMGCLSHIEKRIPANQLCKYCNYK

Amino Acids from 3' Exons

TWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLP,HGIIRLLKPKLNILMVKITHAHSNQICPNLRWKNLTRILWPSLEGHMIWLVRVEGSRSCLMERNC,MDEYDEDFSQNTFWRLHMHNIPTRSVQIDGKTQGYCGPHDKGIFGWFVRGQGHVWKEIA