top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|25627186|25632583|-|TOP2B|ENST00000264331.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9434

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

YAGPEDDAAITLVK

Amino Acids from 5' Exons

DWVLVQLKKQRNILLIWKGIASCLDMLVLKMMLPLP,IGYYSRSKGIFCYGKASHLVICWSRCCHYL,LGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITL

Amino Acids from 3' Exons

VKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKA,KTIYGFLLIALLKIQLLILRLRKTLCSPKVLGLNASCQKNFLK,KKPYMGFYLPYKSNFFSDGKHDSAAQKFWVMPAVRKIFS

bottom of page