McDonnell Genome Institute

Washington University

CircRNA

chr3|25623514|25645455|-|TOP2B|ENST00000424225.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

5

Peptide

RMLDGLDPHPMNNAAK

Amino Acids from 5' Exons

HFSKATFSCCGQPPVPLSTCRAVVYSYNSHGFNKWCGHWYWMGLTTQLCGNCEQCQTNARWPGSSSH,TLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPM,LQGYFFLLWMTTSLSSFMMIINVSLSGIFLFPWFMVLRALVLDGLVNYPTMMLGKLTMSDECMAWILIP

Amino Acids from 3' Exons

NNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDTYIGSVEPLTQ,TMLQKKKSQKLPTKMILQRSCLLRECIRRRHNLNTFFFVLIHILGQWSHR,QCCKKRRVRNCQQKFFKEVVCESVSEEDTTTHSSSSYIYWVSGAIDA