McDonnell Genome Institute

Washington University

CircRNA

chr3|25609567|25618849|-|TOP2B|ENST00000264331.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.973

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

LVLFDHMGCLK

Amino Acids from 5' Exons

GDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEP,VILILQQKWNLMKNSVEHQKVQEKRHLHQFLIKVPNLRGRRRSL,SYCSSKSGIRIQWSTSRRCRRRGIDSISSYKRSQTEGEEGA

Amino Acids from 3' Exons

VLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITI,YFLIIWDVRNMKLCKTFKNSLIYDVITVYVRSGLWECWEQNLQSLTIKPVSFRRYKGKLL,TFSYGMSEEINCARHSERILFTIKLLRFTGVACGNVGSRIYKAQSSPFHFREDTRENYY