McDonnell Genome Institute

Washington University

CircRNA

chr3|23956036|23965162|+|NR1D2|ENST00000312521.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9973

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

5

Peptide

AGTFENLVAWFYCVK

Amino Acids from 5' Exons

NLVAWFYCVKSVGMWRQDSTMEFMLAKAV,IWHGSTVSLWGCGVRIPLWSSCLRRL,FSGMVLLCKVCGDVASGFHYGVHACEGCK

Amino Acids from 3' Exons

VCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFE,FVQVSLHMWILINQDMKSGKNFRASLQQKKWWNLQSVFLGSEISLSMTRSTFRLGLL,LSNEVSICGSSIRTNLGRIFDELHSSSERSGGICKAYSWVQRSLSAPGQPFKGWDF