top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|197829563|197835822|+|LRCH3|ENST00000334859.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9933

43

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

ISHEICIK

Amino Acids from 5' Exons

ICIKGKVHIFKYLNIQACKIAPDLPDYDRRPLGFGS,YVKAKSTYLNTTYKLVRLLQICRIMIGDRWVLAP,MYKRQSPHIIPEHTSLDCSRSAGLETVGFWLL

Amino Acids from 3' Exons

WNMIWIRLTTTAAPQRKRRPRDSPRDQTQTALVHSLWRILNSGESLM,GTSGSDLHRQLHRRGRGGRGETAQGTRPRQPFTVYGVYTAANLS,EHDLDQIDYIDSCTAEEEEAEVRQPKGPDPDSLSSQFMAYIEQRRISHE

bottom of page