McDonnell Genome Institute

Washington University

CircRNA

chr3|197015364|197017290|-|MFI2|ENST00000296350.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

VSQVPPTLHGADPGK

Amino Acids from 5' Exons

GCPPTCAGVCSPLPRSRSVETWPWPSAGSGSSQRSSACQPSPPNTAWSGS,AAPLPALVCALHSRDPEVWRHGRGLPPAAAQARDPVRVSQVPPTLHGADP,LPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQ

Amino Acids from 3' Exons

GRRFPPGARPCCHRTSSCCAGMVAGPMSPSGGSAIWPGCLLTPWWSGPTQMGASSSGCSTKA,EDASLLGPGPAVTGLRAAVPGWPGRCHRVEAVPSGPGACSRRGGPGRHRWGPHLPAAQRRP,KTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ