McDonnell Genome Institute

Washington University

CircRNA

chr3|196801926|196803164|+|PAK2|ENST00000327134.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

YLSFTPPGSK

Amino Acids from 5' Exons

EVKRKKRNGQKFLLHLILSTPSMLALMLLLENS,KKERKGTARNFSSIFAHHPCWLCCYWRIH,SKKKEKERPEISPPSDFEHTIHVGFDAVTGEFT

Amino Acids from 3' Exons

GMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPP,ACQNSGLDYYRPPISPNSKRRILRLCWMSSSTTPTQSRNIALLLL,HARTVGSITTDLQYHQTRAKEESSGCAGCPKVLRLQHSEAEISELYSS