McDonnell Genome Institute

Washington University

CircRNA

chr3|196241947|196257887|-|PCYT1A|ENST00000292823.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9702

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

ELNVSFINGLR

Amino Acids from 5' Exons

ACLLQHRGQKVSPHQTSSPELCGIMMCMRGGTCRGATQQRSSMSALS,HVCSNTEDRRYLHIRHHHPNCAGLCVCEAEPAEGLHSKGAQCQLYQ,MFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFIN

Amino Acids from 3' Exons

GLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTP,AYGNQLLFLMKLKLTLVSPMSGLWKKPAEELL,LTATSSFFNSLALCQGNYGRSQQRNS