McDonnell Genome Institute

Washington University

CircRNA

chr3|195769021|195791497|-|MUC4|ENST00000462323.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9723

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

GHTQAPQTTQESQTTR

Amino Acids from 5' Exons

SNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRSGNPVLMGFS,ATPTKPSSPRTGAGPMPCFSTRAVGCSGTWPSAQATRCSWASL,QHLPSHPLHGREQVLCPVSLPERWDAVGRGPALRQPGAHGLL,SNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRSGNPVLMGFS,ATPTKPSSPRTGAGPMPCFSTRAVGCSGTWPSAQATRCSWASL,QHLPSHPLHGREQVLCPVSLPERWDAVGRGPALRQPGAHGLL

Amino Acids from 3' Exons

EPQRTHLEVKLLPQSPQQAQQQRHRDNQLQLLQGPLIRTYQLHLRTTRLRARRPPAKLKPTPSRRHQLFFLPQVYTMWRQLLQMKPHHFPPVSPTHSHQRLQQPPQTPLLETQKRHQQQELKVLPQPQQSQQLDRKDNHEQLPGGPLSKTHQLLLRTTGLGARRPPGNLKPAPHTEPLQLLLSLQVYTMQGLFLRRHLLQVKQLPHPSVVSQTHPHQRRQQPPQAPLLETQGRHHQYLLLEVLCQSPQQPHLIQKDNHQQLSQGLLLRTQQLFLRTTRLRAWRPPEYLKSTPSTPSHRLQHQLFYPHQVDSTQVEQFLRRHSLLVKQPPHPLPVSAIHSWHQRCSECQPPETLLLETQRRHHYLVEPFLQSLPKFQPYGGQTLCQQHSPPVLYLQKYPQLSTPSRVKVQRPQDGLMRGAHSLQVCLKKYLLYMKQQHGLPHSPAKATQLGHKQNCPQHQQVLPLGLSQEIHLQGQLALFQGSPLRSQQGNQESPPHTPPTAQLSQKQQGQAPRHNGHKKRGPLERLFSAAQATVLRKRPHPHLLHLCWIDTHPNKLQRHHQQIIQQYIPQAPLLRNHQLFPKGVTLKPRRPHKNHKPRGPSPPLTPRQSPPQVLPSQPVGTRPQKLFLRTHPPVQQQPLPQLPPGMVTQPRPRPQHCRQHPAAMMPPWGPQEARHFPKQVPLLWPTLCQHQGAQKDNGHQPLPAPHLTQQQPPIPTRLRAQRPLDKHRPANRPPQGHEPPQRAQLPLPHPGRVAQHLQEAKEYPPQERRQGFHQTPPGTVTQPSQQPNCCPPQPVMVPSQAQEWRLRSSPAPFIPPSLRPPLQGDRQDSQAQLLPVPLLRRQPPFPGWPRLRGQEPAEGLTLSAWRPRQPTPSQQSHPHLHRSHPLGLHLHKPRPTLCHLQGLVKPSPRPSSATPPLFLSPTLPRHPQVTPPLFMSPMLPQYPQVTPPLFLSPALPQYPQVTPPLFLSPTLPQNPQVTSPLFLSPAFPQHPQVTAPLFLSLTLPQHPQVTSPLFLSPAFPQHPQVTPPLFLSLTLPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQYPQVTPPLFMSLMLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQHPQDTPPLFLSPTLPQCPQITPPLFLPSLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPTLPQYPQVTPRLFLSLALPQHPQVTSLLFMSPALPQHPQVTPPLFLSPAFPQHPQVTPCLFLSLALPQHPQVTPPLFLSPTLPQYPQVTPPLFMSLMLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQHPQDTPPLFLSPTLPQCPQITPPLFLPSLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPTLPQYPQVTPRLFLSLALPQHPQVTSLLFMSPALPQHPQVTPPLFLSPAFPQHPQVTPCLFLSLALPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPALPQHLQVTPPLFLSPTLPQHPKVTPPLFLSPALPQHLQVTPPLFLSPTLPQHPQVTPPLFLSPMLPHYPQVTPPLFMSPALPQHPQVTPPLFLSPALPQHPPVTPPLFLSPAFPQLPQMTPPVFLSPTFPRHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPALFLSLTLPQHPQVRPPLFLSPTLPQYPQLTPPHFLSPAFLQLPQMTPPVFLSPTFPRHPQVRPSLFLSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPSLPQHLQVTPPLFLSPTLPQCPQVTPPLFLSPTLPQYPQVTPPLFLSPTLTQHPQVTPPLFMSPTLPQYPQVTPPLFLSPAFPQHPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQCPQVTPPLFLSPTLPQCPQVMPPLFRSPTLPQYLQDRPPLFLSPAFPQHPLVTPRRFLSPILPQHPQVRTPLFLSPAFPQYPQVTPRLFLSLTLPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQYPQVTPPLFMTPMLPHYPQGTPPLFLSPALPQHPQVTPPLFLSPKLPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPALPQHPQVTPSLFLSPTLPQHPQDRPPLFLSPAFPQHPQVTPPLFLSPTLPQCPQVTPPLFLSPAFPQYPQVTPLLFLSLALPQHPQVTPPLFMSPTLPQHPQVTPPLFLSPAFPQHPQVTPRLFLSLALPQHPQVTPPLFMSPTLPQYPQVTPPLFLSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPIFLSPAFPQLPQVTPPVFLSPTFPRHPQVMPPLFLSPALPQHPQVTPPLFLAPTLPQYPQVTPPLFLSPTLRQYPQVTPPVFLSPALPQHLQVTPPLYLSPTLPQHPQVTPPLFLSPMLPHYPHVTPPLFMSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPALPQHPQVTPPLFLSPTLTQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPLLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPPVMPPLFLSPTLPQHPQVTPPLFLSPTLPQHTQVTPPLFLSPTLPHHPQVTPPLFLSPRLPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQYPQVTPPLFMSPALPQHPQVTPPLFLSPTLRQCPQVTPPLFLSPTLPQCSQVMPPLFLSPSLPQHPQVTPPLFLSPTLPQCPQVTPPLFLSPTLPQCPQVMPPLFLSPTLPQCPQVTLPLFLSPAFPQYPQVTPRLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPLFLTPTLPQHPQVTPPFFLSPTLPQHPVTPPLFLSPTLPQYPQVTPPLFMSPALPQHPPVTPPRFLSPTLPQHPQVTPTLFMSPALPQHPPVTPPRFLSPTLPQHPQVTPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPALPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPLLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPPVMPPLFLSPTLPQHPQVTPPLFLSPTLPQHTQVTPPLFLSPTLPHHPQVTPPLFLSPRLPQYPQVTPLLFLSPTLPQHPQVTPPLFMSPALPQHPQVTPPLCLSPTLPQYPQVTPPLFLSPAFPQLPQVTPPVFLSPTFPRHPQVRPPLFLSPTLPQYPQVTPCLFLSLALPQHPQVTPPLFLSPALPQHPPVTPPLFLSPALPQHLQVTPPLFLSPTLPQHPQVTPPLFLSPALPQHLQVTPPLFMSPSLPQHPQVTPALFLSPALPQHPPVTPPLFLSPTLPQYPPVTPRLFLSPAFPQYPQVTPPLFLSPTLPRHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQHPQVTPPVFLSRTLPQHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQHPQVTPPVFLSRTLPQHPQVRPPLFLSPSLPHHPQVTPPLFLSPALPQYLQVTSPLFMSPALPQHPQVTSPLFLSPALPQHPQVTPPLFLSPTLPQCPQVTPRLFLSPTLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPSLPQYPQVTPCLFLSLALPQHPQVTPPLFLLPAFPQLPQVTPPLFLSPTLPQHPHVTPPLFLSPTLPQLPQMTPPVFLSPTFPRHPQDMPPLFLSPALPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPAVPQHPQVTPPPFLSPTLPQYPQVTPPLFLSPALPQYLQVTPPLFLSPALPQHPQVTPPLFLSPALPQHPQVTPPLFLSPMLPHYPQVTPPLFMSPALPQHPEVTPALFLSPMLPQHPPVTPPLFLSPAFPQYPQVTPRLFLSPTLPLHPQVRPPLFLSPAFPQYPQVTPRLFLSPSLPQHPQVTPPLFLSPTLPQCPQVTAPLFLSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPAFPQYPQVTPPLLLSAVLPQLPQYPRTPLRWKHQ,NHRGHINNWKNCCPSHLNRLNNSDTRGTINCSFFKDLSGHISFISEPPDEHGDHQQSSNRHPHADDDINSFFFPKCTQCDGDSSSRNDHIISLQCHQHTHDDIKDYNNDNLHRLHSWKHRRDINSRNKFYPSDLSSLNNSWTGRTITNNFLEDLYPRHISFFSEPLDSEHADHQGISNQHPNTQNHFNSFFLSKCTQCDRDCFSEDISFRNSYLIPLCHKHIHDDIREDNSDNLHRLHSWKPRGDIISTCYWKSYASHLSSLSNISRRTITSNFLKDFYSGHNSFFEPPDSERGDHQSISNQHPQHPHTGYNINCFILTKWIQPKWNSFSGDIPFWNNHLIPFQCQQYIPGNIKGVQNANLQRLYSWKHRGDITICKWNHFCNHFQSFNHMVVRHSVNSTLPQFSTSKNIHSFPHPAERCRDHRTASEELILSRCVSRNIYSTNNNMAFLILQQRPHNLVTNRTALNINRCCHACHRKSIYRDSWHYSKGPLGLSNRGTRRAHHILLPQHNSPKNNRGRRPDTMDTRNGDHWRGSSQQPKLQCDSDDKNGHIPIFFTYAGTHIPTNYNGTINKSFNNTFHKHLSSGITSCFPKGSHSSPADHTRITNHEVRLPHDHQDSHHPRFFLHSQWALALRNCSSGRTHHKCSNNLCPSSHRGWSHNPGPDHSTAGSTQQPCHPGALRRHVTFQNRCPYSGQLCSVNTRGPRRTMDISLCQHLTHSSSHDPYPPGEHRGLWTNTDQRTGLLRVTNHLSGHSYPFLIRGEWHNTFRKRRNIHLRRDDKVFIKPLQGQSHNPVNNRIAVRLSQSWCHPSKHRNGVFDRPRHLSSHPLGLHCRETDRTVKPNFSQCLSSGDSRHFPDGPDSEDKNQQRVHYQPGVPGNRHLLNSPTHTSIDHIHWAYISTNRDPHSVTFRVWNLHHGPHQQRHPSSCHLRFLGIHRSHHPSSCHRCFLSIHRSRHPSSCHQPFLSIHRSHHPSSCHRHFLRIHRSRHPSSCHQLFLSIHRQHPSSCHHFLSIHRSRHPSSCHQPFLSIHRHHPSSCHHFLSIHRSRHLSSCHRHFLSIHRSHHPSSCHRHFLSIHRSRHLSSCHRHFLSIHRSHHPSSCHCFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRHFLSIHRTRHPSSCHRRFLSVHRSRHLSSCNHPFRSIHRSHHPSSCHRHFLSIHRSGHLSSCHRHFLSIHRHHASSCHHFLSIHRSRHSSSCHQPFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRHHPSSCHRRFLSIHRSHHPSSCHCFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRHFLSIHRTRHPSSCHRRFLSVHRSRHLSSCNHPFRSIHRSHHPSSCHRHFLSIHRSGHLSSCHRHFLSIHRHHASSCHHFLSIHRSRHSSSCHQPFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRHHPSSCHRRFLSIHRSHHPSSCHQPFLSIYRSHHPSSCHRHFLSIQRHHPSSCHQPFLSIYRSHHPSSCHRHFLSIHRHHPSSCHQCFLIIHRSRHPSSCHQPFLSIHRSRHPSSCHQHFLSIHRSRHPSSCHRPFLSYHRHHPSSCHRRFLGIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRQPSSCHRFLSIHRSGHPSSCHRHFLSIHSSRHPTSCHRPFFSFHRHHPSSCHRRFLGIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRHHLSSCHHPFLSIFRSHHLSSCHRRFLSVHRSRHLSSCHRRFLSIHRHHPSSCHRHLSIHRHHPSSCHRRFLSIHRSRHLSSCHQPFLSIHRHHASSCHPFLSILRSHHPSSCHRRFLSTHRSRHLSSCHRRFLSVHRSRHPSSCHRRFLSVHRSCHPSSGHRHFLSIYRTGHPSSCHQPFLSIHWHHAASCHRYFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRRFLNIHRSRHLSSCHRRFLSIHRSRHRSSHRCFLIIHRGHHPSSCHQPFLNIHRHHPSSCHRNFLSIHRSRHLSSCHRHFLSIHRSRHLSSCHRHFLSIHRSRHPSSCHRHFLSIHRSGHPSSCHQPFLSIHRSRHPSSCHRHFLSIHRTGHPSSCHQPFLSIHRHHPSSCHRRFLSVHRSRHLSSCHQPFLSIHRHHSSSCHPFLSIHRSRHPSSCHRRFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRRFLSIHRHHPSSCHQLFLSILRSHHPSSCHRRFLSIHRHHPSSCHRHFLSIHRSRHPSSCHRPFLSFHRHHPSSCHQRFLGIHRSCHPSSCHQHFLSIHRHHPSSWHRHFLSIHRSHHPSSCHRRFVSIHRHHPSSCHQPFLSIYRSHHPSTCHRHSLSIHRHHPSSCHQCFLIIHTSRHLSSCHQPFLSIHRSRHLSSCHRHFRSIHRSRHPSSCHQHFLSIHRHHPSSCHRHLLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHSSSCHRRFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSCHLSSCHRHFLSIHRHHLSSCHRHFLSIHRHHLSSCHRHFLIIHRHHPSSCHRDFLSIHRHHPSSCHRHFLSIHRSRHPSSCHQHFLSIHRSRHPSSCHQPFLSIHRSHHPSSCHRRFVSVHRSRHLSSCHRRFLSVHRSCHLSSCHHPFLSILRSHHPSSCHRRFLSVHRSRHLSSCHRRFLSVHRSCHPSSCHRRFLSVHRSRYPSSSHQPFLSIHRHHASSCHRHFLSIHRSGHPSSCHQPFLSIHRHHPSSCHRHFLSIHRSRHLSSCHRHFLSIHRSRHPSSHRHFLSIHRSRHPSSCHRHFLSIHRSRHLSSCHRHFLNIHRSRHPSSCHQPFLSIHRSRHPASCHRHFLSIHRSRQPSSCHQPFLSIHRSRHPASCHRHFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRSHHPSSCHRHFLSIHRSGHRSSCHQHFLSIHRHHPSSCHRHFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHSSSCHRRFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSCHLSSCHRHFLSIHRHHLSSCHRHFLSIHRHHLSSCHRHFLIIHRHHPSSCHRDFLSIHRSRHSSSCHRRFLSIHRSRHPSSCHQPFLSIHRHHPCACHRHFLSIHRSRHPSSCHRPFLSFHRHHPSSCHRHFLGIHRSGHPSSCHQHFLSIHRHHASSCHPFLSIHRSRHPSSCHQHFLSIHRSRHPCSCHQHFLSIYRSHHPSSCHRHFLSIHRHHPSSCHQPFLSIYRSHHPSSCHHPFLSIHRHQHSSCHRRFLSIHRSRHPSSCHRHFLSIHRSRHASSCHQPFLSIHRHHPSSCHRRFLGIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRSRHPSSCHRHFLSIHRHHPSSCHGHFLSIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRSRHPSSCHRHFLSIHRHHPSSCHGHFLSIHRSGHPSSCHHPFLIILRSHHPSSCHQHFLSIYRSRHPSSCHQPFLSIHRSRHPSSCHQHFLSIHRSRHPSSCHRRFLSVHRSRHASSCHRRFLSIHRHHPSSCHRHFLSIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRSRHPSSCHHPFLSIHRHHASSCHPFLSIHRSRHPSSCYRPFLSFHRHHPSSCHRHFLSIHTSRHPSSCHRHFLSFHRHHPSSCHRRFLGIHRTCHPSSCHQHFLSIHRHHPSSCHRHFLSIHRSRHLSSCHQPFLSIHRSRHPPSCHRHFLSIHRSRHPSSCHQHFLSIYRSRHPSSCHQPFLSIHRSRHPCSCHQHFLSIHRHHPSSCHQCFLIIHRSRHPSSCHQPFLSIQRHQHSSCHRCFLSIHRSRHPSSSHQPFLSIHRHHASSCHRHFLCIHRSGHPSSCHQPFLSIHRHHASSCHHPFLSILRSHHLSSCHRRFLSVHRSRHPSSCHQHFLSIHRHHPSSCHRHFLSIHRSRHPSSCHRHFLSIHRSRHPSSCHQPFLSIHRSRHPSCCQQCYLSFHSILGLPSEDGNT,TTEDTLITGSKTAAPVTSTGSTTATLEGQSTAASSRTSNQDISASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETAPPDEMTTSFPSSVTNTLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSIQDTSASSQNHWTRSTQTTRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTSPSGETATSSLCSVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALVTFDPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSGFNPSGTVSQETFPSGETTTSSPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTISAITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQEIFTLHETTTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTGTAGTIPRVPSKVSAIGEPGEPTTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSPSSSPMLDRHTSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVSPMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAAPSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQAESTEASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPSRDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQETAAISRMAQTQRTRTSRGSDTISLASQATDTFSTVPPTPPSITSTGLTSPQTETHTLSPSGSGKTFTTALISNATPLPVTYASSASTGHTTPLHVTDASSVSTGHATPLPVTSPSSVSTGHTTPLPVTDTSSESTGHVTPLPVTSFSSASTGDSTPLPVTDTSSASTGHVTPLPVTSLSSASTGDTTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGHTTPLPVTSPSSASTGHTTPLPVTDTSSASKGDTTPLPVTSPSSASTGHTTPLPVTDTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASTGHATPLPVTSTSSASTGHATPLPVTGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHASPLLVTDASSASTGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDDTTRLPVTDVSSASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSASSGHTTSLPVTDASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPLHVTDASSVSTGHATSLPVTSLSSASTGDTTPLPVTSPSSASSGHTTPLPVTDASSVPTGHATSLPVTDASSVSTGHATPLPVTDASSVSTGHATPLPVTDTSSVSTGQATPLPVTSLSSASTGDTTPLPVTDTSSASTGQDTPLPVTSLSSVSTGDTTPLPVTNPSSASTGHATPLLVTDASSISTGHATSLLVTDASSVSTGHATALHDTDASSLSTGDTTPLPVTSPSSTSTGDTTPLPVTETSSVSTGHATSLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQATPLPVTSPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGHATSLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLHVTDASSASTGHATPLPVTSLSSASTGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHTTPLPVTDASSASTGDTTPLPVTDTSSASTGHATHLPVTGLSSASTGDTTRLPVTNVSSASTGHATPLPVTSTSSASTGDTTPLPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTSPSSASTGHTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVTSPSSASTGHATSLPVTDTSAASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTETSSVSTGDTTPLPVTDTSSASTGHATPLPVTNTSSVSTGHATPLHVTSPSSASTGHTTPLPVTDASSVSTGHATSLPVTDASSVFTGHATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSLPVTDASSVSTGHATPLPVTDASSVSTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSASTGHATLLPVTDTSSASIGHATSLPVTDTSSISTGHATPLHVTSPSSASTGHATPLPVTDTSSASTGHANPLHVTSPSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHTTPLPVTDTSSASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTETSSVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTTPVPVTDTSSVSTGHATPLPVTGLSSASTGDTTRLPVTDISSASTGQATPLPVTNTSSVSTGDTMPLPVTSPSSASTGHATPLPVTSTSSASTGHATPVPVTSTSSASTGHTTPLPVTDTSSASTGDTTPLPVTSPSSASTGHTTPLHVTIPSSASTGDTSTLPVTGASSASTGHATPLPVTDTSSVSTGHATPLPVTSLSSVSTGDTTPLPVTDASSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTGHATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTGHATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTIPSSSSSGHTTPLPVTSTSSVSTGHVTPLHVTSPSSASTGHVTPLPVTSTSSASTGHATPLLVTDASSVSTGHATPLPVTDASSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDASSASTGHATPLPVTIPSSVSTGDTMPLPVTSPSSASTGHATPLPVTGLSSASTGDTTPLPVTDTSSASTRHATPLPVTDTSSASTDDTTRLPVTDVSSASTGHATPLPVTSTSSASTGDTTPLPVTDTSSVSTGHATSLPVTSRSSASTGHATPLPVTDTSSVSTGHATPLPVTSTSSVSTGHATPLPVTSPSSASTGHATPVPVTSTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASRGDTSTLPVTDASSASTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTIPSSASSGHTTSLPVTDASSVSTGHGTPLPVTSTSSASTGDTTPLPVTDTSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGHATPLAVSSATSASTVSSDSPLKMETP,EPQRTHLEVKLLPQSPQQAQQQRHRDNQLQLLQGPLIRTYQLHLRTTRLRARRPPAKLKPTPSRRHQLFFLPQVYTMWRQLLQMKPHHFPPVSPTHSHQRLQQPPQTPLLETQKRHQQQELKVLPQPQQSQQLDRKDNHEQLPGGPLSKTHQLLLRTTGLGARRPPGNLKPAPHTEPLQLLLSLQVYTMQGLFLRRHLLQVKQLPHPSVVSQTHPHQRRQQPPQAPLLETQGRHHQYLLLEVLCQSPQQPHLIQKDNHQQLSQGLLLRTQQLFLRTTRLRAWRPPEYLKSTPSTPSHRLQHQLFYPHQVDSTQVEQFLRRHSLLVKQPPHPLPVSAIHSWHQRCSECQPPETLLLETQRRHHYLVEPFLQSLPKFQPYGGQTLCQQHSPPVLYLQKYPQLSTPSRVKVQRPQDGLMRGAHSLQVCLKKYLLYMKQQHGLPHSPAKATQLGHKQNCPQHQQVLPLGLSQEIHLQGQLALFQGSPLRSQQGNQESPPHTPPTAQLSQKQQGQAPRHNGHKKRGPLERLFSAAQATVLRKRPHPHLLHLCWIDTHPNKLQRHHQQIIQQYIPQAPLLRNHQLFPKGVTLKPRRPHKNHKPRGPSPPLTPRQSPPQVLPSQPVGTRPQKLFLRTHPPVQQQPLPQLPPGMVTQPRPRPQHCRQHPAAMMPPWGPQEARHFPKQVPLLWPTLCQHQGAQKDNGHQPLPAPHLTQQQPPIPTRLRAQRPLDKHRPANRPPQGHEPPQRAQLPLPHPGRVAQHLQEAKEYPPQERRQGFHQTPPGTVTQPSQQPNCCPPQPVMVPSQAQEWRLRSSPAPFIPPSLRPPLQGDRQDSQAQLLPVPLLRRQPPFPGWPRLRGQEPAEGLTLSAWRPRQPTPSQQSHPHLHRSHPLGLHLHKPRPTLCHLQGLVKPSPRPSSATPPLFLSPTLPRHPQVTPPLFMSPMLPQYPQVTPPLFLSPALPQYPQVTPPLFLSPTLPQNPQVTSPLFLSPAFPQHPQVTAPLFLSLTLPQHPQVTSPLFLSPAFPQHPQVTPPLFLSLTLPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQYPQVTPPLFMSLMLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQHPQDTPPLFLSPTLPQCPQITPPLFLPSLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPTLPQYPQVTPRLFLSLALPQHPQVTSLLFMSPALPQHPQVTPPLFLSPAFPQHPQVTPCLFLSLALPQHPQVTPPLFLSPTLPQYPQVTPPLFMSLMLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQHPQDTPPLFLSPTLPQCPQITPPLFLPSLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPTLPQYPQVTPRLFLSLALPQHPQVTSLLFMSPALPQHPQVTPPLFLSPAFPQHPQVTPCLFLSLALPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPALPQHLQVTPPLFLSPTLPQHPKVTPPLFLSPALPQHLQVTPPLFLSPTLPQHPQVTPPLFLSPMLPHYPQVTPPLFMSPALPQHPQVTPPLFLSPALPQHPPVTPPLFLSPAFPQLPQMTPPVFLSPTFPRHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPALFLSLTLPQHPQVRPPLFLSPTLPQYPQLTPPHFLSPAFLQLPQMTPPVFLSPTFPRHPQVRPSLFLSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPSLPQHLQVTPPLFLSPTLPQCPQVTPPLFLSPTLPQYPQVTPPLFLSPTLTQHPQVTPPLFMSPTLPQYPQVTPPLFLSPAFPQHPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQCPQVTPPLFLSPTLPQCPQVMPPLFRSPTLPQYLQDRPPLFLSPAFPQHPLVTPRRFLSPILPQHPQVRTPLFLSPAFPQYPQVTPRLFLSLTLPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQYPQVTPPLFMTPMLPHYPQGTPPLFLSPALPQHPQVTPPLFLSPKLPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPALPQHPQVTPSLFLSPTLPQHPQDRPPLFLSPAFPQHPQVTPPLFLSPTLPQCPQVTPPLFLSPAFPQYPQVTPLLFLSLALPQHPQVTPPLFMSPTLPQHPQVTPPLFLSPAFPQHPQVTPRLFLSLALPQHPQVTPPLFMSPTLPQYPQVTPPLFLSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPIFLSPAFPQLPQVTPPVFLSPTFPRHPQVMPPLFLSPALPQHPQVTPPLFLAPTLPQYPQVTPPLFLSPTLRQYPQVTPPVFLSPALPQHLQVTPPLYLSPTLPQHPQVTPPLFLSPMLPHYPHVTPPLFMSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPALPQHPQVTPPLFLSPTLTQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPLLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPPVMPPLFLSPTLPQHPQVTPPLFLSPTLPQHTQVTPPLFLSPTLPHHPQVTPPLFLSPRLPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQYPQVTPPLFMSPALPQHPQVTPPLFLSPTLRQCPQVTPPLFLSPTLPQCSQVMPPLFLSPSLPQHPQVTPPLFLSPTLPQCPQVTPPLFLSPTLPQCPQVMPPLFLSPTLPQCPQVTLPLFLSPAFPQYPQVTPRLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPLFLTPTLPQHPQVTPPFFLSPTLPQHPVTPPLFLSPTLPQYPQVTPPLFMSPALPQHPPVTPPRFLSPTLPQHPQVTPTLFMSPALPQHPPVTPPRFLSPTLPQHPQVTPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPALPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPQVTPLLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPRLFLSLALPQHPPVMPPLFLSPTLPQHPQVTPPLFLSPTLPQHTQVTPPLFLSPTLPHHPQVTPPLFLSPRLPQYPQVTPLLFLSPTLPQHPQVTPPLFMSPALPQHPQVTPPLCLSPTLPQYPQVTPPLFLSPAFPQLPQVTPPVFLSPTFPRHPQVRPPLFLSPTLPQYPQVTPCLFLSLALPQHPQVTPPLFLSPALPQHPPVTPPLFLSPALPQHLQVTPPLFLSPTLPQHPQVTPPLFLSPALPQHLQVTPPLFMSPSLPQHPQVTPALFLSPALPQHPPVTPPLFLSPTLPQYPPVTPRLFLSPAFPQYPQVTPPLFLSPTLPRHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQHPQVTPPVFLSRTLPQHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQYPQVTPPLFLSPTLPQHPQVTPPVFLSRTLPQHPQVRPPLFLSPSLPHHPQVTPPLFLSPALPQYLQVTSPLFMSPALPQHPQVTSPLFLSPALPQHPQVTPPLFLSPTLPQCPQVTPRLFLSPTLPQHPQVTPPLFLSPTLPQHPQVRPPLFLSPAFPQYPQVTPPLFLSPTLPQHPQVTPPLFLSPSLPQYPQVTPCLFLSLALPQHPQVTPPLFLLPAFPQLPQVTPPLFLSPTLPQHPHVTPPLFLSPTLPQLPQMTPPVFLSPTFPRHPQDMPPLFLSPALPQHPQVTPPLFLSPTLPQYPQVTPPLFLSPAVPQHPQVTPPPFLSPTLPQYPQVTPPLFLSPALPQYLQVTPPLFLSPALPQHPQVTPPLFLSPALPQHPQVTPPLFLSPMLPHYPQVTPPLFMSPALPQHPEVTPALFLSPMLPQHPPVTPPLFLSPAFPQYPQVTPRLFLSPTLPLHPQVRPPLFLSPAFPQYPQVTPRLFLSPSLPQHPQVTPPLFLSPTLPQCPQVTAPLFLSPALPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPTLPQHPQVTPPLFLSPAFPQYPQVTPPLLLSAVLPQLPQYPRTPLRWKHQ,NHRGHINNWKNCCPSHLNRLNNSDTRGTINCSFFKDLSGHISFISEPPDEHGDHQQSSNRHPHADDDINSFFFPKCTQCDGDSSSRNDHIISLQCHQHTHDDIKDYNNDNLHRLHSWKHRRDINSRNKFYPSDLSSLNNSWTGRTITNNFLEDLYPRHISFFSEPLDSEHADHQGISNQHPNTQNHFNSFFLSKCTQCDRDCFSEDISFRNSYLIPLCHKHIHDDIREDNSDNLHRLHSWKPRGDIISTCYWKSYASHLSSLSNISRRTITSNFLKDFYSGHNSFFEPPDSERGDHQSISNQHPQHPHTGYNINCFILTKWIQPKWNSFSGDIPFWNNHLIPFQCQQYIPGNIKGVQNANLQRLYSWKHRGDITICKWNHFCNHFQSFNHMVVRHSVNSTLPQFSTSKNIHSFPHPAERCRDHRTASEELILSRCVSRNIYSTNNNMAFLILQQRPHNLVTNRTALNINRCCHACHRKSIYRDSWHYSKGPLGLSNRGTRRAHHILLPQHNSPKNNRGRRPDTMDTRNGDHWRGSSQQPKLQCDSDDKNGHIPIFFTYAGTHIPTNYNGTINKSFNNTFHKHLSSGITSCFPKGSHSSPADHTRITNHEVRLPHDHQDSHHPRFFLHSQWALALRNCSSGRTHHKCSNNLCPSSHRGWSHNPGPDHSTAGSTQQPCHPGALRRHVTFQNRCPYSGQLCSVNTRGPRRTMDISLCQHLTHSSSHDPYPPGEHRGLWTNTDQRTGLLRVTNHLSGHSYPFLIRGEWHNTFRKRRNIHLRRDDKVFIKPLQGQSHNPVNNRIAVRLSQSWCHPSKHRNGVFDRPRHLSSHPLGLHCRETDRTVKPNFSQCLSSGDSRHFPDGPDSEDKNQQRVHYQPGVPGNRHLLNSPTHTSIDHIHWAYISTNRDPHSVTFRVWNLHHGPHQQRHPSSCHLRFLGIHRSHHPSSCHRCFLSIHRSRHPSSCHQPFLSIHRSHHPSSCHRHFLRIHRSRHPSSCHQLFLSIHRQHPSSCHHFLSIHRSRHPSSCHQPFLSIHRHHPSSCHHFLSIHRSRHLSSCHRHFLSIHRSHHPSSCHRHFLSIHRSRHLSSCHRHFLSIHRSHHPSSCHCFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRHFLSIHRTRHPSSCHRRFLSVHRSRHLSSCNHPFRSIHRSHHPSSCHRHFLSIHRSGHLSSCHRHFLSIHRHHASSCHHFLSIHRSRHSSSCHQPFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRHHPSSCHRRFLSIHRSHHPSSCHCFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRHFLSIHRTRHPSSCHRRFLSVHRSRHLSSCNHPFRSIHRSHHPSSCHRHFLSIHRSGHLSSCHRHFLSIHRHHASSCHHFLSIHRSRHSSSCHQPFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRHHPSSCHRRFLSIHRSHHPSSCHQPFLSIYRSHHPSSCHRHFLSIQRHHPSSCHQPFLSIYRSHHPSSCHRHFLSIHRHHPSSCHQCFLIIHRSRHPSSCHQPFLSIHRSRHPSSCHQHFLSIHRSRHPSSCHRPFLSYHRHHPSSCHRRFLGIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRQPSSCHRFLSIHRSGHPSSCHRHFLSIHSSRHPTSCHRPFFSFHRHHPSSCHRRFLGIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRHHLSSCHHPFLSIFRSHHLSSCHRRFLSVHRSRHLSSCHRRFLSIHRHHPSSCHRHLSIHRHHPSSCHRRFLSIHRSRHLSSCHQPFLSIHRHHASSCHPFLSILRSHHPSSCHRRFLSTHRSRHLSSCHRRFLSVHRSRHPSSCHRRFLSVHRSCHPSSGHRHFLSIYRTGHPSSCHQPFLSIHWHHAASCHRYFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRRFLNIHRSRHLSSCHRRFLSIHRSRHRSSHRCFLIIHRGHHPSSCHQPFLNIHRHHPSSCHRNFLSIHRSRHLSSCHRHFLSIHRSRHLSSCHRHFLSIHRSRHPSSCHRHFLSIHRSGHPSSCHQPFLSIHRSRHPSSCHRHFLSIHRTGHPSSCHQPFLSIHRHHPSSCHRRFLSVHRSRHLSSCHQPFLSIHRHHSSSCHPFLSIHRSRHPSSCHRRFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHPSSCHRRFLSIHRHHPSSCHQLFLSILRSHHPSSCHRRFLSIHRHHPSSCHRHFLSIHRSRHPSSCHRPFLSFHRHHPSSCHQRFLGIHRSCHPSSCHQHFLSIHRHHPSSWHRHFLSIHRSHHPSSCHRRFVSIHRHHPSSCHQPFLSIYRSHHPSTCHRHSLSIHRHHPSSCHQCFLIIHTSRHLSSCHQPFLSIHRSRHLSSCHRHFRSIHRSRHPSSCHQHFLSIHRHHPSSCHRHLLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHSSSCHRRFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSCHLSSCHRHFLSIHRHHLSSCHRHFLSIHRHHLSSCHRHFLIIHRHHPSSCHRDFLSIHRHHPSSCHRHFLSIHRSRHPSSCHQHFLSIHRSRHPSSCHQPFLSIHRSHHPSSCHRRFVSVHRSRHLSSCHRRFLSVHRSCHLSSCHHPFLSILRSHHPSSCHRRFLSVHRSRHLSSCHRRFLSVHRSCHPSSCHRRFLSVHRSRYPSSSHQPFLSIHRHHASSCHRHFLSIHRSGHPSSCHQPFLSIHRHHPSSCHRHFLSIHRSRHLSSCHRHFLSIHRSRHPSSHRHFLSIHRSRHPSSCHRHFLSIHRSRHLSSCHRHFLNIHRSRHPSSCHQPFLSIHRSRHPASCHRHFLSIHRSRQPSSCHQPFLSIHRSRHPASCHRHFLSIHRSRHPSSCHQPFLSIHRHHASSCHPFLSIHRSHHPSSCHRHFLSIHRSGHRSSCHQHFLSIHRHHPSSCHRHFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSRHSSSCHRRFLSIHRSGHPSSCHQPFLSIHRHHASSCHPFLSIHRSCHLSSCHRHFLSIHRHHLSSCHRHFLSIHRHHLSSCHRHFLIIHRHHPSSCHRDFLSIHRSRHSSSCHRRFLSIHRSRHPSSCHQPFLSIHRHHPCACHRHFLSIHRSRHPSSCHRPFLSFHRHHPSSCHRHFLGIHRSGHPSSCHQHFLSIHRHHASSCHPFLSIHRSRHPSSCHQHFLSIHRSRHPCSCHQHFLSIYRSHHPSSCHRHFLSIHRHHPSSCHQPFLSIYRSHHPSSCHHPFLSIHRHQHSSCHRRFLSIHRSRHPSSCHRHFLSIHRSRHASSCHQPFLSIHRHHPSSCHRRFLGIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRSRHPSSCHRHFLSIHRHHPSSCHGHFLSIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRSRHPSSCHRHFLSIHRHHPSSCHGHFLSIHRSGHPSSCHHPFLIILRSHHPSSCHQHFLSIYRSRHPSSCHQPFLSIHRSRHPSSCHQHFLSIHRSRHPSSCHRRFLSVHRSRHASSCHRRFLSIHRHHPSSCHRHFLSIHRSGHPSSCHQPFLSIHRHHPSSCHRRFLSIHRSRHPSSCHHPFLSIHRHHASSCHPFLSIHRSRHPSSCYRPFLSFHRHHPSSCHRHFLSIHTSRHPSSCHRHFLSFHRHHPSSCHRRFLGIHRTCHPSSCHQHFLSIHRHHPSSCHRHFLSIHRSRHLSSCHQPFLSIHRSRHPPSCHRHFLSIHRSRHPSSCHQHFLSIYRSRHPSSCHQPFLSIHRSRHPCSCHQHFLSIHRHHPSSCHQCFLIIHRSRHPSSCHQPFLSIQRHQHSSCHRCFLSIHRSRHPSSSHQPFLSIHRHHASSCHRHFLCIHRSGHPSSCHQPFLSIHRHHASSCHHPFLSILRSHHLSSCHRRFLSVHRSRHPSSCHQHFLSIHRHHPSSCHRHFLSIHRSRHPSSCHRHFLSIHRSRHPSSCHQPFLSIHRSRHPSCCQQCYLSFHSILGLPSEDGNT,TTEDTLITGSKTAAPVTSTGSTTATLEGQSTAASSRTSNQDISASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETAPPDEMTTSFPSSVTNTLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSIQDTSASSQNHWTRSTQTTRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTSPSGETATSSLCSVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALVTFDPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSGFNPSGTVSQETFPSGETTTSSPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTISAITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQEIFTLHETTTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTGTAGTIPRVPSKVSAIGEPGEPTTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSPSSSPMLDRHTSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVSPMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAAPSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQAESTEASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPSRDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQETAAISRMAQTQRTRTSRGSDTISLASQATDTFSTVPPTPPSITSTGLTSPQTETHTLSPSGSGKTFTTALISNATPLPVTYASSASTGHTTPLHVTDASSVSTGHATPLPVTSPSSVSTGHTTPLPVTDTSSESTGHVTPLPVTSFSSASTGDSTPLPVTDTSSASTGHVTPLPVTSLSSASTGDTTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGHTTPLPVTSPSSASTGHTTPLPVTDTSSASKGDTTPLPVTSPSSASTGHTTPLPVTDTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASTGHATPLPVTSTSSASTGHATPLPVTGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHASPLLVTDASSASTGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDDTTRLPVTDVSSASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSASSGHTTSLPVTDASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPLHVTDASSVSTGHATSLPVTSLSSASTGDTTPLPVTSPSSASSGHTTPLPVTDASSVPTGHATSLPVTDASSVSTGHATPLPVTDASSVSTGHATPLPVTDTSSVSTGQATPLPVTSLSSASTGDTTPLPVTDTSSASTGQDTPLPVTSLSSVSTGDTTPLPVTNPSSASTGHATPLLVTDASSISTGHATSLLVTDASSVSTGHATALHDTDASSLSTGDTTPLPVTSPSSTSTGDTTPLPVTETSSVSTGHATSLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQATPLPVTSPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGHATSLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLHVTDASSASTGHATPLPVTSLSSASTGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHTTPLPVTDASSASTGDTTPLPVTDTSSASTGHATHLPVTGLSSASTGDTTRLPVTNVSSASTGHATPLPVTSTSSASTGDTTPLPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTSPSSASTGHTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVTSPSSASTGHATSLPVTDTSAASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTETSSVSTGDTTPLPVTDTSSASTGHATPLPVTNTSSVSTGHATPLHVTSPSSASTGHTTPLPVTDASSVSTGHATSLPVTDASSVFTGHATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSLPVTDASSVSTGHATPLPVTDASSVSTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSASTGHATLLPVTDTSSASIGHATSLPVTDTSSISTGHATPLHVTSPSSASTGHATPLPVTDTSSASTGHANPLHVTSPSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHTTPLPVTDTSSASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTETSSVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTTPVPVTDTSSVSTGHATPLPVTGLSSASTGDTTRLPVTDISSASTGQATPLPVTNTSSVSTGDTMPLPVTSPSSASTGHATPLPVTSTSSASTGHATPVPVTSTSSASTGHTTPLPVTDTSSASTGDTTPLPVTSPSSASTGHTTPLHVTIPSSASTGDTSTLPVTGASSASTGHATPLPVTDTSSVSTGHATPLPVTSLSSVSTGDTTPLPVTDASSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTGHATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTGHATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTIPSSSSSGHTTPLPVTSTSSVSTGHVTPLHVTSPSSASTGHVTPLPVTSTSSASTGHATPLLVTDASSVSTGHATPLPVTDASSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDASSASTGHATPLPVTIPSSVSTGDTMPLPVTSPSSASTGHATPLPVTGLSSASTGDTTPLPVTDTSSASTRHATPLPVTDTSSASTDDTTRLPVTDVSSASTGHATPLPVTSTSSASTGDTTPLPVTDTSSVSTGHATSLPVTSRSSASTGHATPLPVTDTSSVSTGHATPLPVTSTSSVSTGHATPLPVTSPSSASTGHATPVPVTSTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASRGDTSTLPVTDASSASTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTIPSSASSGHTTSLPVTDASSVSTGHGTPLPVTSTSSASTGDTTPLPVTDTSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGHATPLAVSSATSASTVSSDSPLKMETP