McDonnell Genome Institute

Washington University

CircRNA

chr3|195333027|195382022|-|ACAP2|ENST00000326793.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9765

38

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

DLGAQLVK

Amino Acids from 5' Exons

MLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQ,CCHLCMPIWPSFIKDMICLVNLDPTRILVH,VVIYVCPFGLLSSRISVTWTLHEGSWCT

Amino Acids from 3' Exons

LVKLCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVE,LNFVLQLILEKPFVLQINSSMGFETWLSILVMMLSL,CETLYCNDYWKSLLCCKTVHEWDSRPGSVFCCR