McDonnell Genome Institute

Washington University

CircRNA

chr3|193658886|193662962|+|OPA1|ENST00000361150.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9866

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

GVEVDPSLR

Amino Acids from 5' Exons

RVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKD,GLFNTMLWKTDPYLINSNGMQLFILWKRLCRLVSRI,GYSTQCFGRPIHITAMGCSYLFYGRGSAGSSQG

Amino Acids from 3' Exons

CVHNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSL,VFTMKPRMNWRRCNVMRSTQLILQVMKPQSGRTLNPEEKIQA,CSQNQEIGEDVEMGAPSLSCKNNHSPEEPIPRSRSRSKL