McDonnell Genome Institute

Washington University

CircRNA

chr3|193657079|193667280|+|OPA1|ENST00000361150.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

KTSVAWETLQEEFSR

Amino Acids from 5' Exons

VAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSL,LLGRPYKKNFPALQNRKGKSMMTYLINLKRLLRKKVLNDTSGMTLRRTA,CLGDPTRRIFPLYDRTERERAHITRGCGRKYTTQVELCGGQL

Amino Acids from 3' Exons

LGDRKMLKRYWKILLKMVRRRLNCLLVNAFNWRKTS,AIREKCRGIGRFCRWEEDIAYWTRSTGGRP,RRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDL